General Information

  • ID:  hor007065
  • Uniprot ID:  P55752
  • Protein name:  Prolactin-2
  • Gene name:  ASIP
  • Organism:  Alligator mississippiensis
  • Family:  Somatotropin/prolactin family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Alligatorinae; Alligator.
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0005179 hormone activity
  • GO CC:  GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT; GO:0031667 response to nutrient levels; GO:0008284 positive regulation of cell population proliferation

Sequence Information

  • Sequence:  LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHTASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC
  • Length:  199
  • Propeptide:  LPICPSGSVNCQVSLGELFDRAVKLSHYIHFLSSEMFNEFDERYAQGRGFITKAVNGCHTASLTTPEDKEQAQQIHHEDLLNLVLGVLRSWNDPLLHLVTEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVQPGDTGNEVYSRWSGLPSLQLADEDSRLFAFYNLLHCGRRDSHKIDNYLKLLKCRLIHDSNC
  • Signal peptide:  NA
  • Modification:  T33 Sulfocysteine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA